EXOSC7 anticorps (N-Term)

N° du produit ABIN633320

L’anticorps Lapin Polyclonal anti-EXOSC7 a été validé pour WB. Il convient pour détecter EXOSC7 dans des échantillons de Humain et Souris.

Aperçu rapide pour EXOSC7 anticorps (N-Term) (ABIN633320)

Antigène: EXOSC7 (Exosome Component 7 (EXOSC7))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EXOSC7 anticorps

Épitope: N-Term

Specificité: EXOSC7 antibody was raised against the N terminal of EXOSC7

Purification: Affinity purified

Immunogène: EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC7 Blocking Peptide, (ABIN938166), is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC7

Antigène: EXOSC7 (Exosome Component 7 (EXOSC7))

Autre désignation: EXOSC7

Sujet: EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.

Poids moléculaire: 32 kDa (MW of target protein)